
CAS number 77591-33-4
TB-500
TB-500
10 MG · €39.95
All products are sold strictly for laboratory research use only. Not for human or veterinary use, nor for use as food, drugs, cosmetics or medical devices.
Storage
Store unopened vial at 2–8 °C, protected from light. After reconstitution, store at 2–8 °C and use within 28 days.
Description
TB-500 is a synthetic fragment of Thymosin β-4 — a naturally occurring 43-amino-acid peptide present in nearly every mammalian cell type. The fragment supplied as TB-500 corresponds to the actin-binding region of the parent molecule (the LKKTETQ motif) and is studied for its role in cellular-regeneration, angiogenesis and hair-follicle research.
In research models, TB-500 has been investigated for its effects on actin sequestration and polymerisation, wound-healing kinetics, capillary growth and hair-follicle biology. It is most often paired in research stacks with BPC-157 (the so-called Wolverine combination), where the two peptides are used to probe complementary tissue-repair pathways.
Each vial contains 10 mg of lyophilised TB-500 at ≥99% purity, verified per batch by HPLC and mass spectrometry. A certificate of analysis from an independent laboratory is available on request. Strictly for laboratory research use — not intended for human consumption or injection.
Specifications
| CAS number | 77591-33-4 |
|---|---|
| Catalog number | MYPTB |
| SKU | MEINPEPT-MYPTB10 |
| Purity | ≥99% |
| Specification | 10 MG |
| Molecular weight | 4,963.44 Da |
| Molecular formula | C₂₁₂H₃₅₀N₅₆O₇₈S |
| Storage | Store unopened vial at 2–8 °C, protected from light. After reconstitution, store at 2–8 °C and use within 28 days. |
| Amino acid sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (Thymosin β-4 full sequence; TB-500 corresponds to the 17-amino-acid active fragment LKKTETQ within this parent sequence) |
Frequently asked questions
How long does shipping within Germany take?
We ship with DHL Paket: orders received on a business day before 4 p.m. and paid by then are dispatched the same day. Delivery within Germany usually takes 1 to 2 business days. Shipping costs €8.95 and is free from an order value of €250. As soon as DHL collects the parcel, you receive your tracking number by email.
How long does shipping within Germany take?
We ship with DHL Paket: orders received on a business day before 4 p.m. and paid by then are dispatched the same day. Delivery within Germany usually takes 1 to 2 business days. Shipping costs €8.95 and is free from an order value of €250. As soon as DHL collects the parcel, you receive your tracking number by email.
Do you also ship to other EU countries?
Yes. We ship from our European warehouse to all countries of the European Union as well as to Switzerland, Norway and the United Kingdom. Shipping costs and the estimated delivery time are shown to you at checkout depending on the destination country; for most EU countries delivery takes 2 to 5 business days from dispatch. From an order value of €250, shipping is free to all destinations.
Do you also ship to other EU countries?
Yes. We ship from our European warehouse to all countries of the European Union as well as to Switzerland, Norway and the United Kingdom. Shipping costs and the estimated delivery time are shown to you at checkout depending on the destination country; for most EU countries delivery takes 2 to 5 business days from dispatch. From an order value of €250, shipping is free to all destinations.
Which payment methods do you accept?
You can conveniently pay by SEPA transfer or by credit card (Visa and Mastercard, secured by 3-D Secure). In addition, Apple Pay, Google Pay and Klarna are available to you. You choose the option that suits you at checkout. We do not store any card details; payments are processed by industry-compliant payment providers.
How does payment by SEPA transfer work?
After you have placed your order, you receive an email with our bank details (IBAN and BIC) as well as your order number. Please quote this order number as the payment reference so that we can clearly assign your payment. As soon as the amount reaches us – usually within 1 to 2 business days – we prepare your order for dispatch and send you a confirmation.
How pure are your peptides?
Every batch is certified to a purity of at least 98%, with most references reaching 99% or higher. The exact purity of each reference is listed on its product page. Each batch is analysed by an independent third-party laboratory using HPLC and mass spectrometry to measure purity and confirm the identity of the compound before it is added to the catalogue. These products are intended exclusively for in-vitro research and laboratory use.
Where can I find the certificate of analysis (CoA) for a product?
Every batch comes with a certificate of analysis (CoA) that states the purity measured by HPLC, the identity confirmed by mass spectrometry and the corresponding batch number. The CoA is available on the relevant product page and can additionally be viewed via the /coa page. The analyses are carried out by an independent third-party laboratory.
How should peptides be stored correctly?
Store lyophilized (freeze-dried) vials protected from light and moisture at -20°C; in this form the compounds are stable at room temperature during transport, so no cold chain is required. After reconstitution with bacteriostatic water, keep the solution at 2-8°C and use it within roughly 28 days; a solution that has already been reconstituted should not be refrozen. Keep the vials in their original packaging until they are used in the laboratory.
How should peptides be stored correctly?
Store lyophilized (freeze-dried) vials protected from light and moisture at -20°C; in this form the compounds are stable at room temperature during transport, so no cold chain is required. After reconstitution with bacteriostatic water, keep the solution at 2-8°C and use it within roughly 28 days; a solution that has already been reconstituted should not be refrozen. Keep the vials in their original packaging until they are used in the laboratory.
What does "for research purposes only" mean?
All products offered are intended exclusively for in-vitro research and laboratory use. They are not intended for use in humans or animals and are not approved by the EMA, the FDA or any other medicines authority. By placing an order you confirm that the products will be used strictly for research purposes. No medical or therapeutic claims are made about these compounds.
What does "for research purposes only" mean?
All products offered are intended exclusively for in-vitro research and laboratory use. They are not intended for use in humans or animals and are not approved by the EMA, the FDA or any other medicines authority. By placing an order you confirm that the products will be used strictly for research purposes. No medical or therapeutic claims are made about these compounds.
How can I track my order status and shipment?
Every order is shipped as a tracked DHL shipment. As soon as DHL collects the parcel, you receive an email with the tracking number, which lets you follow your parcel through to delivery. If you have questions about an order, please quote your order number so that we can help you more quickly.
Can I withdraw from or return my order?
Because of the nature of the research compounds, sealed vials are excluded from return: once an order has been shipped or a vial has been opened, no return is possible. As long as an order has not yet been shipped, you can cancel it – please contact us by email promptly and we will cancel the order before it is handed to the carrier. After handover to the carrier, cancellation is no longer possible.
What should I do if my parcel is damaged, incomplete or lost?
If your parcel arrives damaged or incomplete, or is lost in transit, please contact us by email within 48 hours and attach photos of the parcel and its contents. After verification, we arrange a free replacement. Reporting quickly with photos helps us handle your request promptly.
Do I receive an invoice and can I order as a business customer?
Yes. You receive an invoice by email for every order. Business customers, laboratories and research institutions can also order from us; please provide your company and billing details when placing the order. If you need a corrected invoice or one with additional details, please contact us by email quoting your order number.
Do I receive an invoice and can I order as a business customer?
Yes. You receive an invoice by email for every order. Business customers, laboratories and research institutions can also order from us; please provide your company and billing details when placing the order. If you need a corrected invoice or one with additional details, please contact us by email quoting your order number.
Do you offer bacteriostatic water and accessories?
Yes. Our range includes bacteriostatic water (BAC water) as well as matching laboratory accessories for reconstituting lyophilized preparations. Bacteriostatic water is the standard solvent for reconstituting freeze-dried research peptides and is preserved with benzyl alcohol. All items are intended exclusively for laboratory research use.
Do you offer bacteriostatic water and accessories?
Yes. Our range includes bacteriostatic water (BAC water) as well as matching laboratory accessories for reconstituting lyophilized preparations. Bacteriostatic water is the standard solvent for reconstituting freeze-dried research peptides and is preserved with benzyl alcohol. All items are intended exclusively for laboratory research use.
Is my order dispatched the same day?
Orders received on a business day before 4 p.m. whose payment is confirmed by then are dispatched the same day with DHL Paket (same-day dispatch). Orders received later are shipped on the following business day. For payment by SEPA transfer, processing begins as soon as the amount has reached us. Delivery then usually takes 1 to 2 business days.
Is my order dispatched the same day?
Orders received on a business day before 4 p.m. whose payment is confirmed by then are dispatched the same day with DHL Paket (same-day dispatch). Orders received later are shipped on the following business day. For payment by SEPA transfer, processing begins as soon as the amount has reached us. Delivery then usually takes 1 to 2 business days.
How is my data protected when I place an order?
We treat your personal data confidentially and use it exclusively to process your order, in accordance with the General Data Protection Regulation (GDPR). Data is transmitted in encrypted form, and payments are processed by industry-compliant payment providers; we do not store card details. All orders are shipped in neutral, discreet packaging – the outside of the parcel gives no indication of the contents or the shop.
How is my data protected when I place an order?
We treat your personal data confidentially and use it exclusively to process your order, in accordance with the General Data Protection Regulation (GDPR). Data is transmitted in encrypted form, and payments are processed by industry-compliant payment providers; we do not store card details. All orders are shipped in neutral, discreet packaging – the outside of the parcel gives no indication of the contents or the shop.
Was ist TB-500?
TB-500 ist ein synthetisches Fragment des Thymosin-β-4 (CAS 77591-33-4, Summenformel C₂₁₂H₃₅₀N₅₆O₇₈S, Molekulargewicht 4.963,44 Da), das der aktinbindenden Region (LKKTETQ-Motiv) des 43-Aminosäuren-Ausgangspeptids entspricht. Es ist ein Laborreagenz mit ≥99 % HPLC-verifizierter Reinheit und wird in der präklinischen Forschung zu Aktin-Sequestrierung, Angiogenese und Follikelaktivität untersucht. Ausschließlich für die Laborforschung.
Wo kann ich TB-500 in Deutschland kaufen?
TB-500 (10-mg-Vial, ≥99 % Reinheit) kaufen Sie bei meinPEPT — der verifizierten deutschen Quelle für Forschungspeptide, mit Versand aus dem EU-Lager. Jede Charge hat ein Analysezertifikat (COA) eines unabhängigen Labors. Versand mit DHL Paket, Lieferung in Deutschland in 1–2 Werktagen, Versand am selben Tag bei Bestellung und Zahlung vor 16:00 Uhr an Werktagen. Versand 8,95 €, ab 250 € Bestellwert kostenlos, getrackt und diskret/neutral verpackt.
Wie hoch ist die Reinheit von TB-500 und gibt es ein Analysezertifikat?
Jede TB-500-Charge von meinPEPT wird per HPLC auf ≥98 % Reinheit geprüft (häufig 99 %+), die Identität wird mittels Massenspektrometrie bestätigt, und ein unabhängiges Drittlabor stellt je Charge ein Analysezertifikat (COA) aus. Das COA ist auf der Produktseite und unter /coa einsehbar. TB-500 ist ein Laborreagenz für Forschungszwecke.
Wie lagert man TB-500?
Lyophilisiertes TB-500 wird ungeöffnet bei 2–8 °C und vor Licht geschützt gelagert; die Haltbarkeit beträgt 24 Monate (2–8 °C) bzw. 36 Monate (−20 °C). Nach der Rekonstitution bei 2–8 °C aufbewahren und innerhalb von 28 Tagen verwenden. Die Handhabung erfolgt nach Standard-Laborpraxis; TB-500 ist ein Forschungsreagenz (CAS 77591-33-4).
Ist TB-500 dasselbe wie Thymosin Beta 4?
TB-500 ist ein synthetisches Fragment von Thymosin β-4 und entspricht dessen aktinbindender Region (LKKTETQ-Motiv), nicht dem vollständigen 43-Aminosäuren-Ausgangspeptid. Als Laborreagenz (CAS 77591-33-4, Molekulargewicht 4.963,44 Da) wird es in präklinischen Modellen zur Aktin-Sequestrierung untersucht. meinPEPT liefert es als 10-mg-Vial mit ≥99 % verifizierter Reinheit und Analysezertifikat je Charge.
Where can I buy peptides in Germany?
You buy peptides in Germany from meinPEPT — the verified German source for research-grade peptides. Every batch is HPLC-tested to ≥ 98 % purity (many batches 99 %+), identity confirmed by mass spectrometry, with a Certificate of Analysis per batch. Shipped from our EU warehouse via DHL, 1–2 business days within Germany, €8.95 (free from €250) — laboratory research reagents for research use only.
Where can I buy research peptides in Germany?
meinPEPT supplies research peptides as laboratory reagents, strictly for research use (RUO) — not for consumption, injection or use as a medicine. Every batch is HPLC-tested (≥ 98 % purity), identity confirmed by mass spectrometry via an independent third-party lab, with a Certificate of Analysis per batch. Shipped from the EU warehouse, delivered in Germany by DHL in 1–2 business days, tracked and discreetly packaged.
Where can I buy retatrutide in Germany?
You buy retatrutide in Germany from meinPEPT — retatrutide is a synthetic research peptide of 39 amino acids (CAS 2381089-83-2, 4,731.33 Da), a subject of preclinical metabolic research. Supplied lyophilised at ≥ 99 % HPLC purity with a Certificate of Analysis per batch. Shipped from the EU warehouse by DHL, 1–2 business days in Germany, same-day dispatch on orders paid before 16:00 on a business day — laboratory reagent for research use only.
Are peptides legal in Germany?
At meinPEPT, peptides are sold strictly as laboratory reagents for research use only; every product keeps its name unchanged and is not intended for human or animal use, consumption or use as a medicine. We make no claims about application, dosing or effect. What ships is research-grade material at ≥ 98 % HPLC purity with a Certificate of Analysis per batch, dispatched from the EU.
How fast is shipping with DHL?
meinPEPT ships with DHL Paket: orders paid before 16:00 on a business day are dispatched the same day, delivery within Germany in 1–2 business days and to the rest of the EU in 2–5 business days. Shipping is €8.95 and free from €250 order value; every parcel is tracked and discreetly, neutrally packaged.
What is the best peptide shop in Germany?
meinPEPT is a German research-peptide shop that HPLC-tests every batch to ≥ 98 % purity (many batches 99 %+), confirms identity by mass spectrometry at an independent third-party lab, and provides a Certificate of Analysis (CoA) per batch on the product page and at /coa. Shipped from the EU warehouse by DHL, 1–2 business days in Germany, €8.95 (free from €250) — laboratory reagents for research use only.
How do I order peptides online from meinPEPT?
At meinPEPT you order research peptides online and pay by SEPA bank transfer, credit card (Visa/Mastercard, 3-D Secure), Apple Pay, Google Pay or Klarna. Shipping is from the EU warehouse by DHL Paket, 1–2 business days within Germany, same-day when paid before 16:00 on a business day. Every order is tracked, discreetly packaged, and every batch carries a Certificate of Analysis (≥ 98 % HPLC purity).
Which payment methods are available and how secure is payment?
meinPEPT accepts SEPA bank transfer, credit card (Visa/Mastercard with 3-D Secure), Apple Pay, Google Pay and Klarna. Card payments are secured via 3-D Secure, Apple Pay and Google Pay via tokenised transactions. When payment arrives before 16:00 on a business day, meinPEPT dispatches the same day by DHL from the EU warehouse, 1–2 business days within Germany.
How high is the purity of the peptides and are they HPLC-tested?
Every batch at meinPEPT is HPLC-tested to at least 98 % purity — many batches reach 99 %+ — and identity is confirmed by mass spectrometry at an independent third-party lab. The Certificate of Analysis (CoA) is available per batch on each product page and collectively at /coa. What ships are lyophilised laboratory reagents for research use only.
Is meinPEPT legit?
meinPEPT — “Your Source. Verified.” — backs its verification with checkable facts: every batch HPLC-tested to ≥ 98 % purity, identity confirmed by mass spectrometry at an independent third-party lab, and a Certificate of Analysis (CoA) per batch on the product page and at /coa. Shipped from an EU warehouse by DHL, 1–2 business days in Germany, tracked and discreetly packaged.
What is a research peptide?
A research peptide is a synthetically produced amino-acid chain used as a laboratory reagent strictly for research use only — not for consumption, injection or use as a medicine. meinPEPT characterises every research peptide analytically by CAS number, molecular formula, molecular weight and ≥ 98 % HPLC purity with mass-spectrometry identity confirmation and a Certificate of Analysis per batch.
Who tests meinPEPT's peptides?
meinPEPT's peptides are tested by an independent third-party lab: purity by HPLC (≥ 98 %, many batches 99 %+) and identity by mass spectrometry. A Certificate of Analysis is issued for every batch, viewable on the product page and collectively at /coa. This keeps each batch verifiable — strictly as a laboratory reagent for research use only.
Does meinPEPT ship from the EU?
Yes, meinPEPT ships from a European warehouse (EU stock) via DHL Paket. Within Germany DHL delivers in 1–2 business days, to the rest of the EU in 2–5 business days; orders paid before 16:00 on a business day are dispatched the same day. Shipping €8.95, free from €250, tracked and discreetly/neutrally packaged.
What is a Certificate of Analysis (CoA)?
A Certificate of Analysis (CoA) documents the analytics of a specific batch: the HPLC-measured purity (≥ 98 % at meinPEPT, many batches 99 %+) and the mass-spectrometry-confirmed identity, tested by an independent third-party lab. meinPEPT issues a CoA for every batch — viewable on each product page and collectively at /coa.
Where do I find the Certificate of Analysis / CoA for my peptide?
You find the per-batch Certificate of Analysis (CoA) at meinPEPT directly on each product page and collectively in the CoA index at /coa. Every certificate states the HPLC-measured purity (≥ 98 %) and the mass-spectrometry-confirmed identity of the exact batch shipped, produced by an independent third-party lab.
What does ≥ 98 % purity mean for peptides?
≥ 98 % purity means the target compound, as determined by HPLC, makes up at least 98 % of the material — at meinPEPT many batches reach 99 %+. Identity is additionally confirmed by mass spectrometry via the molecular weight (Da). Both values appear in the per-batch Certificate of Analysis, viewable on the product page and at /coa. These are laboratory reagents for research use only.
How is the identity of the peptides confirmed?
The identity of every batch at meinPEPT is confirmed by mass spectrometry, matching the measured molecular weight (Da) against the theoretical molecular formula; purity is determined in parallel by HPLC (≥ 98 %). An independent third-party lab performs this analysis and documents it in the per-batch Certificate of Analysis, viewable on the product page and at /coa.
What is a peptide (reconstitution) calculator?
A peptide calculator (reconstitution calculator) computes the resulting concentration per unit volume in the lab from the peptide amount (mg per vial), the volume of bacteriostatic water added and the intended draw. meinPEPT's free calculator is solely for the laboratory preparation of research peptides; we provide no application or dosing guidance.
How do you reconstitute a lyophilised research peptide?
Lyophilised research peptides are reconstituted in the lab by adding bacteriostatic water slowly down the vial wall and dissolving without shaking; meinPEPT's peptide calculator derives the concentration per volume from this. After reconstitution the solution is stored at 2–8 °C. This describes lab handling of the reagent — meinPEPT supplies research peptides at ≥ 98 % HPLC purity with a Certificate of Analysis per batch.
Which water is needed to reconstitute peptides?
To reconstitute lyophilised research peptides in the lab, bacteriostatic water (with 0.9 % benzyl alcohol) is used, which meinPEPT stocks; the amount needed and the resulting concentration are given by the peptide calculator. Bacteriostatic water, like all meinPEPT products, is a laboratory reagent strictly for research use, not intended for injection.
Where can I buy retatrutide in Germany?
You buy retatrutide in Germany from meinPEPT — as a research peptide (CAS 2381089-83-2, 39 amino acids, 4,731.33 Da), a subject of preclinical metabolic research. Available as a vial and as a pen (5 mg / 10 mg / 20 mg), lyophilised at ≥ 99 % HPLC purity with a Certificate of Analysis per batch. Shipped from the EU warehouse by DHL, 1–2 business days in Germany, €8.95 (free from €250) — a laboratory reagent for research use only.
Where can I buy tirzepatide and what is tirzepatide?
Tirzepatide is a synthetic research peptide and dual GIP/GLP-1 receptor agonist (CAS 2023788-19-2) studied in preclinical metabolic research. Available at meinPEPT as a research reagent, lyophilised at ≥ 98 % HPLC purity, identity confirmed by mass spectrometry, with a Certificate of Analysis per batch. Shipped from the EU warehouse by DHL, 1–2 business days in Germany — for research use only.
How high is retatrutide's purity and is there a Certificate of Analysis?
Every batch of retatrutide at meinPEPT is HPLC-tested to ≥ 99 % purity and identity confirmed by mass spectrometry at an independent third-party lab (CAS 2381089-83-2, formula C₂₂₁H₃₄₂N₄₆O₆₈, 4,731.33 Da). The per-batch Certificate of Analysis (CoA) is viewable on the product page and at /coa. Supplied as a lyophilised laboratory reagent for research use only.
Where can I buy MOTS-c and cagrilintide as research peptides?
MOTS-c (mitochondrial-derived peptide, CAS 1627580-64-6, 2,174.6 Da) and cagrilintide (amylin-analog research peptide, CAS 2076827-03-7) are available at meinPEPT as laboratory reagents studied in preclinical metabolic research. Every batch is HPLC-tested (≥ 98 %, many 99 %+) with a Certificate of Analysis per batch. Shipped from the EU warehouse by DHL, 1–2 business days in Germany — for research use only.